- Recombinant Inner membrane amino-acid ABC transporter permease protein yecS (yecS)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1099027
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 24,801 Da
- E Coli or Yeast
- Inner membrane amino-acid ABC transporter permease protein yecS (yecS)
- 1-222
Sequence
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYISIFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWEAAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK